PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00000947-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family LFY
Protein Properties Length: 414aa    MW: 47675.1 Da    PI: 7.5761
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00000947-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY576.37.9e-176144131386
           FLO_LFY   1 mdpeafsaslfkwdpraaaaapp..arlleeaavseapleaaaaaaark.lreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                       md+e+f++ +f+wd+r+aa+ ++  +++++++  + +ple    ++ rk l++le+lf++yGvry+t+ak++e+Gft++tLv+m++ee++dlm
  PSME_00000947-RA  14 MDAENFPVGFFRWDQRPAATVAAatTTVFNKD--HGRPLEIILPMNGRKeLKSLEDLFREYGVRYSTLAKMTEMGFTANTLVNMTEEEIEDLM 104
                       9*************887775544115555554..5677788899998888******************************************* PP

           FLO_LFY  91 kslseifrldllvGeryGikaavraerrrlee..........eeaekkrrkllsedeetaldalsqeglseepvqe..eke.aagsggeglge 170
                       k+l+ei+++dll+GeryGik+a+rae++rl++          +e  ++r+++l++d++t   al++eg+s+e + +   ++ +++s+++  ++
  PSME_00000947-RA 105 KTLIEIYHMDLLIGERYGIKSAIRAEKKRLQDslemqrleilSE--AERKRILHDDQNTFAAALASEGTSKELRGNdpLIFpESTSADHAPMN 195
                       ********************************999999987544..55555799******************999855334455665544444 PP

           FLO_LFY 171 aelvaaeekkseeekkkaskkkqkrk..kkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCre 261
                        ++ + ++   +++++ +  +       ++++++ e++ d+++++ + +++ gedge+r+rehPfivtepge+argkknGLDYLfdLyeqC++
  PSME_00000947-RA 196 IASCKDSTLILQNSNQAQFCSSGLIGmpEHSSESDERKADTNKQKRRRSKEPGEDGEDRPREHPFIVTEPGELARGKKNGLDYLFDLYEQCGK 288
                       4444333333333333332222222200222222334555566666677789***************************************** PP

           FLO_LFY 262 fLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwd 354
                       fLl+vq+iake+GekcPtkvtnqvfr+ak++ga+yinkPkmrhYvhCYalhcLd+e+sn+lrr +kergenvGawrqacy+plvaia++++wd
  PSME_00000947-RA 289 FLLEVQRIAKEKGEKCPTKVTNQVFRHAKHNGAVYINKPKMRHYVHCYALHCLDSEQSNHLRRIYKERGENVGAWRQACYYPLVAIARENNWD 381
                       ********************************************************************************************* PP

           FLO_LFY 355 idavfnahprLsiWYvPtkLrqLChlerskas 386
                       i+++fn++++L+iWYvPtkLrqLCh+ersk++
  PSME_00000947-RA 382 IEGIFNRNEKLKIWYVPTKLRQLCHMERSKEC 413
                       *****************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.6E-14214411IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MVKSALHSTS ETNMDAENFP VGFFRWDQRP AATVAAATTT VFNKDHGRPL EIILPMNGRK  60
ELKSLEDLFR EYGVRYSTLA KMTEMGFTAN TLVNMTEEEI EDLMKTLIEI YHMDLLIGER  120
YGIKSAIRAE KKRLQDSLEM QRLEILSEAE RKRILHDDQN TFAAALASEG TSKELRGNDP  180
LIFPESTSAD HAPMNIASCK DSTLILQNSN QAQFCSSGLI GMPEHSSESD ERKADTNKQK  240
RRRSKEPGED GEDRPREHPF IVTEPGELAR GKKNGLDYLF DLYEQCGKFL LEVQRIAKEK  300
GEKCPTKVTN QVFRHAKHNG AVYINKPKMR HYVHCYALHC LDSEQSNHLR RIYKERGENV  360
GAWRQACYYP LVAIARENNW DIEGIFNRNE KLKIWYVPTK LRQLCHMERS KECQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A2e-992464114169FLORICAULA/LEAFY HOMOLOG 1
4bhk_B2e-992464114169FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankPRU767570.0U76757.1 Pinus radiata FLORICAULA/LEAFY-like protein (NEEDLY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978027.11e-145hypothetical protein SELMODRAFT_417910
SwissprotO044070.0NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLA0A0K0M7300.0A0A0K0M730_PINTB; NEEDLY
STRINGEFJ206841e-144(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-112floral meristem identity control protein LEAFY (LFY)